A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10236 |
Swiss-prot Accession number | Q7YRC3 (Sequence in FASTA format) |
Description | Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)]. |
Source organism | Macropus eugenii (Tammar wallaby) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus. |
Subcellular location | Cytoplasm (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 44 Amino acids |
Molecular weight | 5037 |
References | 1 PubMed abstract 15008146 |
Domain Name | Thymosin |
Hormone Name | Thymosin beta-4 |
Mature Hormone Sequence | SDKPDMGEIQKFNKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10237 |
Swiss-prot Accession number | Q7YRC3 (Sequence in FASTA format) |
Description | Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)]. |
Source organism | Macropus eugenii (Tammar wallaby) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus. |
Subcellular location | Cytoplasm (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Seraspenide inhibits the entry of hematopoietic pluripotent stem cells into the S-phase |
Protein Length | 44 Amino acids |
Molecular weight | 5037 |
References | 1 PubMed abstract 15008146 |
Domain Name | Thymosin |
Hormone Name | Hematopoietic system regulatory peptide |
Mature Hormone Sequence | SDKP |
Position of mature hormone in Pre-Hormone protein | 4 Residues from position (2-5) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10488 |
Swiss-prot Accession number | P68126 (Sequence in FASTA format) |
Description | Cholecystokinin (CCK). |
Source organism | Macropus eugenii (Tammar wallaby) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion |
Protein Length | 8 Amino acids |
Molecular weight | 1064 |
References | 1 PubMed abstract 3375140 |
Domain Name | N/A |
Hormone Name | Cholecystokinin |
Mature Hormone Sequence | DYMGWMDF |
Position of mature hormone in Pre-Hormone protein | 8 Residues from position (1-8) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |